Welcome to ElSheepO.ca
Default Language
English English
CAD Currency
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Categories
Cart
0
Product Details
FINAL DESTINATION 5 8x10 w/11x14 mat SIGNED by x5 and JSA CERTIFIED*
FINAL DESTINATION 5 8x10 w/11x14 mat SIGNED by x5 and JSA CERTIFIED*
FINAL DESTINATION 5 8x10 w/11x14 mat SIGNED by x5 and JSA CERTIFIED*

FINAL DESTINATION 5 8x10 w/11x14 mat SIGNED by x5 and JSA CERTIFIED*

Product Code: UipMD0Y
Product Condition: New
$295.00 inc. tax
 Add to Cart
Description
FINAL DESTINATION 5 8x10 w/11x14 mat SIGNED by Devon Sawa, David Koechner, Arlen Escarpeta, Courtney Vance and Jacqueline Maclnnes Wood and JSA CERTIFIED* crease at the bottom of the photo
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i